Enzyme Commission Number
EC 3.4.21.4
Product Overview
Trypsin is a serine protease that specifically cleaves lysine and arginine C-terminal peptide bonds. The amino acid sequence of the recombinant trypsin is exactly the same as the trypsin derived from porcine pancreas, and has the same enzymatic properties as the porcine trypsin derived from animal. It can replace trypsin derived from porcine pancreas in various in a biotechnological process. The optimal pH of recombinant trypsin is 7.0-11.0.
Features
Ready-to-use product, accelerating research progress, enhancing application performance.
Applications
Pharmaceutical Industry
Shelf Life
Stored in lyophilized form at -18°C, it is stable for 24 months.
Color / Form
freeze-dried white, off-white powder
Instruction
Avoid multiple freeze-thaw cycles.
Avoid inhalation during use, prevent contact with skin or mucous membranes, and rinse with water immediately after accidental contact.
Production Methods
Recombinant trypsin, produced by genetic engineering, expressed in Escherichia coli
Specific Enzyme Activity
≥3800 USP units/mg pro
Amino Acids Sequence
IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPWVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
Shipping
Timely shipping by optional means
Specification
On customer requests
