Product Overview
Aprotinin is a competitive inhibitor of serine protease, which can inhibit the activity of trypsin, chymotrypsin and kininogenase. Aprotinin forms stable complexes with proteases to block the active sites of the enzymes. Most of the aprotinin-protease complex is unbound at pH <3.0. Aprotinin and protease are effectively combined equimolarly. Recombinant aprotinin is expressed by recombinant Escherichia coli and obtained by multiple column purifications. The amino acid sequence is completely consistent with that of bovine aprotinin. The recombinant aprotinin has the same enzymatic properties as animal-derived aprotinin. Alternative to animal-derived aprotinin in various biotechnological processes.
Features
Ready-to-use product, accelerating research progress, enhancing application performance.
Applications
Pharmaceutical Industry
Shelf Life
Stored in lyophilized form at -18°C, it is stable for 24 months.
Color / Form
freeze-dried white to light yellow powder
Instruction
Avoid multiple freeze-thaw cycles.
Avoid inhalation during use, prevent contact with skin or mucous membranes, and rinse with water immediately after accidental contact.
Production Methods
Recombinant bovine aprotinin, produced by genetic engineering, expressed in Escherichia coli
Specific Enzyme Activity
≥3.0 EPU/mg pro
Unit Definition
The activity that can inhibit one trypsin unit is called an aprotinin activity unit (EPU).
Amino Acids Sequence
MGSSHHHHHHSSGLVPRGSHMRPDFCLEPPYTGPCKARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCGGA
Shipping
Timely shipping by optional means
Specification
On customer requests
